PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC09G03970.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 437aa    MW: 48094.4 Da    PI: 10.5746
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC09G03970.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.31.7e-332377155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     ++rlrWt+eLHerFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  OPUNC09G03970.3 23 RQRLRWTNELHERFVEAVTQLGGPDRATPKGVLRIMGVQGLTIYHVKSHLQKYRL 77
                     58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7112080IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-322278IPR009057Homeodomain-like
SuperFamilySSF466899.14E-182277IPR009057Homeodomain-like
TIGRFAMsTIGR015579.4E-262478IPR006447Myb domain, plants
PfamPF002497.2E-92576IPR001005SANT/Myb domain
PfamPF143791.1E-22110155IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF096966.5E-5377427IPR018607Chromosome transmission fidelity protein 8
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007064Biological Processmitotic sister chromatid cohesion
GO:0005634Cellular Componentnucleus
GO:0031390Cellular ComponentCtf18 RFC-like complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MELGGNNMEP DNGANNNSNL AARQRLRWTN ELHERFVEAV TQLGGPDRAT PKGVLRIMGV  60
QGLTIYHVKS HLQKYRLAKY IPDSSADGNK AENKDPGDLL AGLEGSSGLQ ISEALKLQME  120
VQKRLHEQLE VQRQLQLRIE AQGKYLKKII EEQQRLGGVK SETPAAGASI TLPSDQFPDS  180
ERTDPSTPAP TSESPTQGVP SNRDNGGRNE ATKSPHRDDS LSRHEPLTPD SNCQPGSPTA  240
SPKHERAAKR QRGNGTEFSE TDFALPHSIF ESSSGSEFQQ CSMSYSDPRA VRVRRGGVPG  300
VGHRGGAGRG AATAVLLRPH PGPPHRPPLR RRRRLPVFQG KNHLLLLLRL RRRHFTFSID  360
SIAGADTVSI YLQAAFTFTV GYHELAGNKV ALKKPLLVLR KKKTAAETEL EVIGVIRHKI  420
LFKDRPKALI SSNQLIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1328334LRRRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1032410.0AK103241.1 Oryza sativa Japonica Group cDNA clone:J033123H06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611984.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
TrEMBLA0A0E0LZH80.0A0A0E0LZH8_ORYPU; Uncharacterized protein
STRINGLOC_Os09g12770.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-82G2-like family protein